Lineage for d7alqs_ (7alq S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966181Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 2966342Protein automated matches [195794] (2 species)
    not a true protein
  7. 2966343Species Human (Homo sapiens) [TaxId:9606] [396510] (9 PDB entries)
  8. 3084036Domain d7alqs_: 7alq S: [420353]
    Other proteins in same PDB: d7alqd_, d7alqq_
    automated match to d1fb1a_
    complexed with hbi, k, qbq, zn

Details for d7alqs_

PDB Entry: 7alq (more details), 2.21 Å

PDB Description: human gch-gfrp inhibitory complex 7-deaza-gtp bound
PDB Compounds: (S:) GTP cyclohydrolase 1

SCOPe Domain Sequences for d7alqs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7alqs_ d.96.1.1 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetisdvl
ndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklariveiysr
rlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvfred
pktreefltlir

SCOPe Domain Coordinates for d7alqs_:

Click to download the PDB-style file with coordinates for d7alqs_.
(The format of our PDB-style files is described here.)

Timeline for d7alqs_:

  • d7alqs_ is new in SCOPe 2.08-stable