Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins) |
Protein automated matches [195794] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [396510] (9 PDB entries) |
Domain d7alqm_: 7alq M: [420336] Other proteins in same PDB: d7alqd_, d7alqq_ automated match to d1fb1a_ complexed with hbi, k, qbq, zn |
PDB Entry: 7alq (more details), 2.21 Å
SCOPe Domain Sequences for d7alqm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7alqm_ d.96.1.1 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]} prseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetisdvl ndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklariveiysr rlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvfred pktreefltlir
Timeline for d7alqm_: