Lineage for d7al9g_ (7al9 G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006220Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165
  4. 3006221Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) (S)
    automatically mapped to Pfam PF06399
  5. 3006222Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins)
  6. 3006260Protein automated matches [394245] (1 species)
    not a true protein
  7. 3006261Species Human (Homo sapiens) [TaxId:9606] [394246] (7 PDB entries)
  8. 3084003Domain d7al9g_: 7al9 G: [420320]
    automated match to d1wplk_
    complexed with k, phe

Details for d7al9g_

PDB Entry: 7al9 (more details), 1.75 Å

PDB Description: human gtp cyclohydrolase i feedback regulatory protein (gfrp) in complex with phenylalanine
PDB Compounds: (G:) GTP cyclohydrolase 1 feedback regulatory protein

SCOPe Domain Sequences for d7al9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7al9g_ d.205.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pyllistqirmevgptmvgdeqsdpelmqhlgaskrralgnnfyeyyvddpprivldkle
rrgfrvlsmtgvgqtlvwclhke

SCOPe Domain Coordinates for d7al9g_:

Click to download the PDB-style file with coordinates for d7al9g_.
(The format of our PDB-style files is described here.)

Timeline for d7al9g_:

  • d7al9g_ is new in SCOPe 2.08-stable