SCOPe 2.08: Domain d7afxb_: 7afx B:

Lineage for d7afxb_ (7afx B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)

8. Domain d7afxb_: 7afx B: [420308]
   automated match to d5lsca_
   complexed with fmt, r9k, zn

Details for d7afxb_

PDB Entry: 7afx, 1.64 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim2 with 139

PDB Compounds: (B:) beta-lactamase vim-2

SCOPe Domain Sequences for d7afxb_:

Sequence; same for both SEQRES and ATOM records:

>d7afxb_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
geyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgak
ntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegnei
pthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagn
vadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

Timeline for d7afxb_:

• d7afxb_ is new in SCOPe 2.08-stable