Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165 |
Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) automatically mapped to Pfam PF06399 |
Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins) |
Protein automated matches [394245] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [394246] (7 PDB entries) |
Domain d7albb_: 7alb b: [420296] Other proteins in same PDB: d7alba_, d7albd_, d7albe_, d7albf_, d7albi_, d7albk_, d7albl_, d7albn_, d7albp_, d7albs_ automated match to d1wplk_ complexed with phe, qbq, zn |
PDB Entry: 7alb (more details), 1.98 Å
SCOPe Domain Sequences for d7albb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7albb_ d.205.1.1 (b:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pyllistqirmevgptmvgdeqsdpelmqhlgaskrralgnnfyeyyvddpprivldkle rrgfrvlsmtgvgqtlvwclhke
Timeline for d7albb_: