Lineage for d7alaj1 (7ala J:1-84)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006220Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165
  4. 3006221Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) (S)
    automatically mapped to Pfam PF06399
  5. 3006222Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins)
  6. 3006260Protein automated matches [394245] (1 species)
    not a true protein
  7. 3006261Species Human (Homo sapiens) [TaxId:9606] [394246] (7 PDB entries)
  8. 3083948Domain d7alaj1: 7ala J:1-84 [420265]
    Other proteins in same PDB: d7alaa_, d7alab_, d7alac_, d7alad_, d7alae_, d7alaf2, d7alai2, d7alaj2
    automated match to d1wplk_
    complexed with 5rw, na, zn

Details for d7alaj1

PDB Entry: 7ala (more details), 1.85 Å

PDB Description: human gch-gfrp inhibitory complex
PDB Compounds: (J:) GTP cyclohydrolase 1 feedback regulatory protein

SCOPe Domain Sequences for d7alaj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7alaj1 d.205.1.1 (J:1-84) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpyllistqirmevgptmvgdeqsdpelmqhlgaskrralgnnfyeyyvddpprivldkl
errgfrvlsmtgvgqtlvwclhke

SCOPe Domain Coordinates for d7alaj1:

Click to download the PDB-style file with coordinates for d7alaj1.
(The format of our PDB-style files is described here.)

Timeline for d7alaj1:

  • d7alaj1 is new in SCOPe 2.08-stable

3083948
d7alaj1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d7alaj2