SCOPe 2.08: Domain d7aeza1: 7aez A:42-270

Lineage for d7aeza1 (7aez A:42-270)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d7aeza1: 7aez A:42-270 [420250]
   Other proteins in same PDB: d7aeza2
   automated match to d4rl0a_
   complexed with edo, etx, gol, na, r8w, zn

Details for d7aeza1

PDB Entry: 7aez, 1.02 Å

PDB Description: crystal structure of the metallo-beta-lactamase ndm-7 with 407

PDB Compounds: (A:) Metallo-beta-lactamase NDM-7

SCOPe Domain Sequences for d7aeza1:

Sequence; same for both SEQRES and ATOM records:

>d7aeza1 d.157.1.0 (A:42-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmnalhaagiatyanalsnqlapqeglvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d7aeza1:

• d7aeza1 is new in SCOPe 2.08-stable