Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries) |
Domain d7a3da_: 7a3d A: [420161] automated match to d6xvma_ complexed with gol, peg, pge, so4; mutant |
PDB Entry: 7a3d (more details), 2.2 Å
SCOPe Domain Sequences for d7a3da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a3da_ b.34.2.1 (A:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvaps
Timeline for d7a3da_: