Lineage for d1g3il_ (1g3i L:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84802Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 84803Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 84882Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 84883Protein HslV (ClpQ) protease [56258] (2 species)
  7. 84900Species Haemophilus influenzae [TaxId:727] [56260] (2 PDB entries)
  8. 84909Domain d1g3il_: 1g3i L: [41997]
    Other proteins in same PDB: d1g3ia_, d1g3ib_, d1g3ic_, d1g3id_, d1g3ie_, d1g3if_, d1g3is_, d1g3it_, d1g3iu_, d1g3iv_, d1g3iw_, d1g3ix_

Details for d1g3il_

PDB Entry: 1g3i (more details), 3.41 Å

PDB Description: crystal structure of the hsluv protease-chaperone complex

SCOP Domain Sequences for d1g3il_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3il_ d.153.1.4 (L:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1g3il_:

Click to download the PDB-style file with coordinates for d1g3il_.
(The format of our PDB-style files is described here.)

Timeline for d1g3il_: