Lineage for d1g3ij_ (1g3i J:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36677Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 36678Protein HslV (ClpQ) protease [56258] (2 species)
  7. 36695Species Haemophilus influenzae [TaxId:727] [56260] (2 PDB entries)
  8. 36702Domain d1g3ij_: 1g3i J: [41995]
    Other proteins in same PDB: d1g3ia_, d1g3ib_, d1g3ic_, d1g3id_, d1g3ie_, d1g3if_, d1g3is_, d1g3it_, d1g3iu_, d1g3iv_, d1g3iw_, d1g3ix_

Details for d1g3ij_

PDB Entry: 1g3i (more details), 3.41 Å

PDB Description: crystal structure of the hsluv protease-chaperone complex

SCOP Domain Sequences for d1g3ij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ij_ d.153.1.4 (J:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1g3ij_:

Click to download the PDB-style file with coordinates for d1g3ij_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ij_: