SCOP 1.73: Domain d1g3kc_: 1g3k C:

Lineage for d1g3kc_ (1g3k C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (3 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)

8. Domain d1g3kc_: 1g3k C: [41991]
   complexed with na

Details for d1g3kc_

PDB Entry: 1g3k, 1.9 Å

PDB Description: crystal structure of the h. influenzae protease hslv at 1.9 a resolution

PDB Compounds: (C:) ATP-dependent protease hslv

SCOP Domain Sequences for d1g3kc_:

Sequence; same for both SEQRES and ATOM records:

>d1g3kc_ d.153.1.4 (C:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

Timeline for d1g3kc_:

• d1g3kc_ first appeared (with stable ids) in SCOP 1.55
  
• d1g3kc_ appears in SCOP 1.71
  
• d1g3kc_ appears in SCOP 1.75
  
• d1g3kc_ appears in the current release, SCOPe 2.08