Lineage for d1g4bp_ (1g4b P:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36677Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 36678Protein HslV (ClpQ) protease [56258] (2 species)
  7. 36679Species Escherichia coli [TaxId:562] [56259] (4 PDB entries)
  8. 36694Domain d1g4bp_: 1g4b P: [41988]
    Other proteins in same PDB: d1g4be_, d1g4bf_, d1g4bk_, d1g4bl_

Details for d1g4bp_

PDB Entry: 1g4b (more details), 7 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism

SCOP Domain Sequences for d1g4bp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4bp_ d.153.1.4 (P:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

SCOP Domain Coordinates for d1g4bp_:

Click to download the PDB-style file with coordinates for d1g4bp_.
(The format of our PDB-style files is described here.)

Timeline for d1g4bp_: