SCOP 1.59: Domain d1g4bn_: 1g4b N:

Lineage for d1g4bn_ (1g4b N:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (2 species)

7. Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)

8. Domain d1g4bn_: 1g4b N: [41986]
   Other proteins in same PDB: d1g4be_, d1g4bf_, d1g4bk_, d1g4bl_

Details for d1g4bn_

PDB Entry: 1g4b, 7 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism

SCOP Domain Sequences for d1g4bn_:

Sequence; same for both SEQRES and ATOM records:

>d1g4bn_ d.153.1.4 (N:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

Timeline for d1g4bn_:

• d1g4bn_ first appeared (with stable ids) in SCOP 1.55
  
• d1g4bn_ appears in SCOP 1.57
  
• d1g4bn_ appears in SCOP 1.61
  
• d1g4bn_ appears in the current release, SCOPe 2.08