Lineage for d1e94d_ (1e94 D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36677Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 36678Protein HslV (ClpQ) protease [56258] (2 species)
  7. 36679Species Escherichia coli [TaxId:562] [56259] (4 PDB entries)
  8. 36683Domain d1e94d_: 1e94 D: [41980]
    Other proteins in same PDB: d1e94e_, d1e94f_

Details for d1e94d_

PDB Entry: 1e94 (more details), 2.8 Å

PDB Description: hslv-hslu from e.coli

SCOP Domain Sequences for d1e94d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e94d_ d.153.1.4 (D:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOP Domain Coordinates for d1e94d_:

Click to download the PDB-style file with coordinates for d1e94d_.
(The format of our PDB-style files is described here.)

Timeline for d1e94d_: