Lineage for d1g65r_ (1g65 R:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138489Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 138490Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 138590Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 138647Protein Proteasome alpha subunit (non-catalytic) [56255] (2 species)
  7. 138663Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries)
  8. 138702Domain d1g65r_: 1g65 R: [41970]
    Other proteins in same PDB: d1g651_, d1g652_, d1g65h_, d1g65i_, d1g65j_, d1g65k_, d1g65l_, d1g65m_, d1g65n_, d1g65v_, d1g65w_, d1g65x_, d1g65y_, d1g65z_

Details for d1g65r_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors

SCOP Domain Sequences for d1g65r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65r_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOP Domain Coordinates for d1g65r_:

Click to download the PDB-style file with coordinates for d1g65r_.
(The format of our PDB-style files is described here.)

Timeline for d1g65r_: