Lineage for d1g0uo_ (1g0u O:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225043Domain d1g0uo_: 1g0u O: [41953]
    Other proteins in same PDB: d1g0u1_, d1g0u2_, d1g0uh_, d1g0ui_, d1g0uj_, d1g0uk_, d1g0ul_, d1g0um_, d1g0un_, d1g0uv_, d1g0uw_, d1g0ux_, d1g0uy_, d1g0uz_
    different sequences
    complexed with mg

Details for d1g0uo_

PDB Entry: 1g0u (more details), 2.4 Å

PDB Description: a gated channel into the proteasome core particle
PDB Compounds: (O:) Proteasome component Y7

SCOPe Domain Sequences for d1g0uo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0uo_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetlskv
slltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqs
ggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndele
ledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsqein
drleal

SCOPe Domain Coordinates for d1g0uo_:

Click to download the PDB-style file with coordinates for d1g0uo_.
(The format of our PDB-style files is described here.)

Timeline for d1g0uo_: