Lineage for d1rypr_ (1ryp R:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36677Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 36711Protein Proteasome alpha subunit (non-catalytic) [56255] (2 species)
  7. 36712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (3 PDB entries)
  8. 36723Domain d1rypr_: 1ryp R: [41942]
    Other proteins in same PDB: d1ryp1_, d1ryp2_, d1ryph_, d1rypi_, d1rypj_, d1rypk_, d1rypl_, d1rypm_, d1rypn_, d1rypv_, d1rypw_, d1rypx_, d1rypy_, d1rypz_

Details for d1rypr_

PDB Entry: 1ryp (more details), 1.9 Å

PDB Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution

SCOP Domain Sequences for d1rypr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rypr_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOP Domain Coordinates for d1rypr_:

Click to download the PDB-style file with coordinates for d1rypr_.
(The format of our PDB-style files is described here.)

Timeline for d1rypr_: