Lineage for d1rypa_ (1ryp A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197868Protein Proteasome alpha subunit (non-catalytic) [56255] (3 species)
  7. 197884Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries)
  8. 197885Domain d1rypa_: 1ryp A: [41932]
    Other proteins in same PDB: d1ryp1_, d1ryp2_, d1ryph_, d1rypi_, d1rypj_, d1rypk_, d1rypl_, d1rypm_, d1rypn_, d1rypv_, d1rypw_, d1rypx_, d1rypy_, d1rypz_

Details for d1rypa_

PDB Entry: 1ryp (more details), 1.9 Å

PDB Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution

SCOP Domain Sequences for d1rypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOP Domain Coordinates for d1rypa_:

Click to download the PDB-style file with coordinates for d1rypa_.
(The format of our PDB-style files is described here.)

Timeline for d1rypa_: