Lineage for d1pmao_ (1pma O:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 875859Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 875875Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (6 PDB entries)
  8. 875910Domain d1pmao_: 1pma O: [41931]
    Other proteins in same PDB: d1pma1_, d1pma2_, d1pmab_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_

Details for d1pmao_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum
PDB Compounds: (O:) proteasome

SCOP Domain Sequences for d1pmao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmao_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOP Domain Coordinates for d1pmao_:

Click to download the PDB-style file with coordinates for d1pmao_.
(The format of our PDB-style files is described here.)

Timeline for d1pmao_: