Lineage for d1pman_ (1pma N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990901Species Thermoplasma acidophilum [TaxId:2303] [56256] (8 PDB entries)
  8. 2990935Domain d1pman_: 1pma N: [41930]
    Other proteins in same PDB: d1pma1_, d1pma2_, d1pmab_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_

Details for d1pman_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum
PDB Compounds: (N:) proteasome

SCOPe Domain Sequences for d1pman_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pman_ d.153.1.4 (N:) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d1pman_:

Click to download the PDB-style file with coordinates for d1pman_.
(The format of our PDB-style files is described here.)

Timeline for d1pman_: