Lineage for d1pmae_ (1pma E:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612721Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 612722Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 612861Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 612946Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 612962Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (1 PDB entry)
  8. 612966Domain d1pmae_: 1pma E: [41921]
    Other proteins in same PDB: d1pma1_, d1pma2_, d1pmab_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_

Details for d1pmae_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum

SCOP Domain Sequences for d1pmae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmae_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOP Domain Coordinates for d1pmae_:

Click to download the PDB-style file with coordinates for d1pmae_.
(The format of our PDB-style files is described here.)

Timeline for d1pmae_: