Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species) contains an extension to the common fold at the N-terminus |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (1 PDB entry) |
Domain d1pmad_: 1pma D: [41920] Other proteins in same PDB: d1pma1_, d1pma2_, d1pmab_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_ |
PDB Entry: 1pma (more details), 3.4 Å
SCOP Domain Sequences for d1pmad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmad_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum} tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl gikalkssleegeelkapeiasitvgnkyriydqeevkkfl
Timeline for d1pmad_:
View in 3D Domains from other chains: (mouse over for more information) d1pma1_, d1pma2_, d1pmaa_, d1pmab_, d1pmac_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_ |