Lineage for d1g65n_ (1g65 N:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 736244Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 736289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (9 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 736312Domain d1g65n_: 1g65 N: [41910]
    Other proteins in same PDB: d1g65a_, d1g65b_, d1g65c_, d1g65d_, d1g65e_, d1g65f_, d1g65g_, d1g65o_, d1g65p_, d1g65q_, d1g65r_, d1g65s_, d1g65t_, d1g65u_

Details for d1g65n_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors
PDB Compounds: (N:) protein (proteasome component pre3)

SCOP Domain Sequences for d1g65n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65n_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOP Domain Coordinates for d1g65n_:

Click to download the PDB-style file with coordinates for d1g65n_.
(The format of our PDB-style files is described here.)

Timeline for d1g65n_: