Lineage for d1g65k_ (1g65 K:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36677Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 36770Protein Proteasome beta subunit (catalytic) [56252] (2 species)
  7. 36771Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (3 PDB entries)
  8. 36805Domain d1g65k_: 1g65 K: [41907]
    Other proteins in same PDB: d1g65a_, d1g65b_, d1g65c_, d1g65d_, d1g65e_, d1g65f_, d1g65g_, d1g65o_, d1g65p_, d1g65q_, d1g65r_, d1g65s_, d1g65t_, d1g65u_

Details for d1g65k_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors

SCOP Domain Sequences for d1g65k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65k_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
ttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlgs
qcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgtr
lkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhvt
edgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOP Domain Coordinates for d1g65k_:

Click to download the PDB-style file with coordinates for d1g65k_.
(The format of our PDB-style files is described here.)

Timeline for d1g65k_: