Lineage for d1g65h_ (1g65 H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1935363Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1935372Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935629Domain d1g65h_: 1g65 H: [41904]
    Other proteins in same PDB: d1g65a_, d1g65b_, d1g65c_, d1g65d_, d1g65e_, d1g65f_, d1g65g_, d1g65o_, d1g65p_, d1g65q_, d1g65r_, d1g65s_, d1g65t_, d1g65u_
    different sequences
    complexed with mg

Details for d1g65h_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors
PDB Compounds: (H:) Proteasome component PUP1

SCOPe Domain Sequences for d1g65h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65h_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d1g65h_:

Click to download the PDB-style file with coordinates for d1g65h_.
(The format of our PDB-style files is described here.)

Timeline for d1g65h_: