SCOP 1.71: Domain d1g65h

Lineage for d1g65h_ (1g65 H:)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)
N-terminal residue provides two catalytic groups, nucleophile and proton donor
Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
Protein Proteasome beta subunit (catalytic) [56252] (5 species)

Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (4 PDB entries)
The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

Domain d1g65h_: 1g65 H: [41904]
Other proteins in same PDB: d1g65a_, d1g65b_, d1g65c_, d1g65d_, d1g65e_, d1g65f_, d1g65g_, d1g65o_, d1g65p_, d1g65q_, d1g65r_, d1g65s_, d1g65t_, d1g65u_

Details for d1g65h_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors

SCOP Domain Sequences for d1g65h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65h_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOP Domain Coordinates for d1g65h_:

Click to download the PDB-style file with coordinates for d1g65h_.
(The format of our PDB-style files is described here.)

Timeline for d1g65h_: