Lineage for d1g0uw_ (1g0u W:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612721Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 612722Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 612861Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 613064Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 613088Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (4 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 613113Domain d1g0uw_: 1g0u W: [41898]
    Other proteins in same PDB: d1g0ua_, d1g0ub_, d1g0uc_, d1g0ud_, d1g0ue_, d1g0uf_, d1g0ug_, d1g0uo_, d1g0up_, d1g0uq_, d1g0ur_, d1g0us_, d1g0ut_, d1g0uu_

Details for d1g0uw_

PDB Entry: 1g0u (more details), 2.4 Å

PDB Description: a gated channel into the proteasome core particle

SCOP Domain Sequences for d1g0uw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0uw_ d.153.1.4 (W:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOP Domain Coordinates for d1g0uw_:

Click to download the PDB-style file with coordinates for d1g0uw_.
(The format of our PDB-style files is described here.)

Timeline for d1g0uw_: