Lineage for d1g0um_ (1g0u M:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (12 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 876246Domain d1g0um_: 1g0u M: [41895]
    Other proteins in same PDB: d1g0ua_, d1g0ub_, d1g0uc_, d1g0ud_, d1g0ue_, d1g0uf_, d1g0ug_, d1g0uo_, d1g0up_, d1g0uq_, d1g0ur_, d1g0us_, d1g0ut_, d1g0uu_
    different sequences

Details for d1g0um_

PDB Entry: 1g0u (more details), 2.4 Å

PDB Description: a gated channel into the proteasome core particle
PDB Compounds: (M:) Proteasome component PRE4

SCOP Domain Sequences for d1g0um_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0um_ d.153.1.4 (M:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOP Domain Coordinates for d1g0um_:

Click to download the PDB-style file with coordinates for d1g0um_.
(The format of our PDB-style files is described here.)

Timeline for d1g0um_: