Lineage for d1rypz_ (1ryp Z:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 512929Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 513132Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 513156Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (4 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 513184Domain d1rypz_: 1ryp Z: [41887]
    Other proteins in same PDB: d1rypa_, d1rypb_, d1rypc_, d1rypd_, d1rype_, d1rypf_, d1rypg_, d1rypo_, d1rypp_, d1rypq_, d1rypr_, d1ryps_, d1rypt_, d1rypu_

Details for d1rypz_

PDB Entry: 1ryp (more details), 1.9 Å

PDB Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution

SCOP Domain Sequences for d1rypz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rypz_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOP Domain Coordinates for d1rypz_:

Click to download the PDB-style file with coordinates for d1rypz_.
(The format of our PDB-style files is described here.)

Timeline for d1rypz_: