Lineage for d1rypx_ (1ryp X:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1438333Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1438342Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438354Domain d1rypx_: 1ryp X: [41885]
    Other proteins in same PDB: d1rypa_, d1rypb_, d1rypc_, d1rypd_, d1rype_, d1rypf_, d1rypg_, d1rypo_, d1rypp_, d1rypq_, d1rypr_, d1ryps_, d1rypt_, d1rypu_
    different sequences
    complexed with mg

Details for d1rypx_

PDB Entry: 1ryp (more details), 1.9 Å

PDB Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution
PDB Compounds: (X:) 20S proteasome

SCOPe Domain Sequences for d1rypx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rypx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d1rypx_:

Click to download the PDB-style file with coordinates for d1rypx_.
(The format of our PDB-style files is described here.)

Timeline for d1rypx_: