Lineage for d1pmar_ (1pma R:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876146Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (6 PDB entries)
  8. 876173Domain d1pmar_: 1pma R: [41865]
    Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_

Details for d1pmar_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum
PDB Compounds: (R:) proteasome

SCOP Domain Sequences for d1pmar_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmar_ d.153.1.4 (R:) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d1pmar_:

Click to download the PDB-style file with coordinates for d1pmar_.
(The format of our PDB-style files is described here.)

Timeline for d1pmar_: