Lineage for d1pmaq_ (1pma Q:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223291Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1223720Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries)
  8. 1223739Domain d1pmaq_: 1pma Q: [41864]
    Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_

Details for d1pmaq_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum
PDB Compounds: (Q:) proteasome

SCOPe Domain Sequences for d1pmaq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmaq_ d.153.1.4 (Q:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d1pmaq_:

Click to download the PDB-style file with coordinates for d1pmaq_.
(The format of our PDB-style files is described here.)

Timeline for d1pmaq_: