Lineage for d3pvad_ (3pva D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222756Family d.153.1.3: Penicillin V acylase [56248] (2 proteins)
  6. 1222757Protein Penicillin V acylase [56249] (1 species)
  7. 1222758Species Bacillus sphaericus [TaxId:1421] [56250] (2 PDB entries)
  8. 1222766Domain d3pvad_: 3pva D: [41857]

Details for d3pvad_

PDB Entry: 3pva (more details), 2.8 Å

PDB Description: penicillin v acylase from b. sphaericus
PDB Compounds: (D:) protein (penicillin v acylase)

SCOPe Domain Sequences for d3pvad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvad_ d.153.1.3 (D:) Penicillin V acylase {Bacillus sphaericus [TaxId: 1421]}
csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst
ditspvlydgvnekglmgamlyyatfatyadepkkgttginpvyvisqvlgncvtvddvi
ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnspgye
whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte
kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris
avslmaenlnsqdlitfewdrkqdikqlnqvnvm

SCOPe Domain Coordinates for d3pvad_:

Click to download the PDB-style file with coordinates for d3pvad_.
(The format of our PDB-style files is described here.)

Timeline for d3pvad_: