SCOPe 2.08: Domain d1eccb2: 1ecc B:1-249

Lineage for d1eccb2 (1ecc B:1-249)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (3 species)

7. Species Escherichia coli [TaxId:562] [56241] (5 PDB entries)

8. Domain d1eccb2: 1ecc B:1-249 [41825]
   Other proteins in same PDB: d1ecca1, d1eccb1
   complexed with mn, onl, pcp

Details for d1eccb2

PDB Entry: 1ecc, 2.4 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with mn-cprpp and 5-oxo-norleucine

PDB Compounds: (B:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1eccb2:

Sequence; same for both SEQRES and ATOM records:

>d1eccb2 d.153.1.1 (B:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs

Timeline for d1eccb2:

• d1eccb2 first appeared (with stable ids) in SCOP 1.55
  
• d1eccb2 appears in SCOPe 2.07