Lineage for d1gmsg_ (1gms G:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335536Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 335537Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 335538Family d.153.1.1: Class II glutamine amidotransferases [56236] (5 proteins)
    has slightly different topology than other families do
  6. 335569Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 335570Species Escherichia coli [TaxId:562] [56238] (3 PDB entries)
  8. 335578Domain d1gmsg_: 1gms G: [41811]
    complexed with act, hga, na

Details for d1gmsg_

PDB Entry: 1gms (more details), 1.85 Å

PDB Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate

SCOP Domain Sequences for d1gmsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmsg_ d.153.1.1 (G:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq

SCOP Domain Coordinates for d1gmsg_:

Click to download the PDB-style file with coordinates for d1gmsg_.
(The format of our PDB-style files is described here.)

Timeline for d1gmsg_: