Lineage for d1gmse_ (1gms E:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 419897Family d.153.1.1: Class II glutamine amidotransferases [56236] (5 proteins)
    has slightly different topology than other families do
  6. 419937Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 419938Species Escherichia coli [TaxId:562] [56238] (3 PDB entries)
  8. 419945Domain d1gmse_: 1gms E: [41810]

Details for d1gmse_

PDB Entry: 1gms (more details), 1.85 Å

PDB Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate

SCOP Domain Sequences for d1gmse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmse_ d.153.1.1 (E:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnl

SCOP Domain Coordinates for d1gmse_:

Click to download the PDB-style file with coordinates for d1gmse_.
(The format of our PDB-style files is described here.)

Timeline for d1gmse_: