![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
![]() | Protein automated matches [191005] (3 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (6 PDB entries) |
![]() | Domain d7edau_: 7eda U: [418089] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edax_ automated match to d2axtu1 complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edau_:
Sequence, based on SEQRES records: (download)
>d7edau_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt erqkqilrenlehftvtevetalveggdrynnglyk
>d7edau_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivksvvllterqkqilrenl ehftvtvetalveggdrynnglyk
Timeline for d7edau_: