Lineage for d7edau_ (7eda U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716633Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2716660Protein automated matches [191005] (3 species)
    not a true protein
  7. 2716670Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (6 PDB entries)
  8. 2716676Domain d7edau_: 7eda U: [418089]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edax_
    automated match to d2axtu1
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edau_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d7edau_:

Sequence, based on SEQRES records: (download)

>d7edau_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk

Sequence, based on observed residues (ATOM records): (download)

>d7edau_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivksvvllterqkqilrenl
ehftvtvetalveggdrynnglyk

SCOPe Domain Coordinates for d7edau_:

Click to download the PDB-style file with coordinates for d7edau_.
(The format of our PDB-style files is described here.)

Timeline for d7edau_:

  • d7edau_ is new in SCOPe 2.08-stable