![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
![]() | Protein Manganese-stabilising protein, PsbO [161116] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries) |
![]() | Domain d7edao_: 7eda O: [418087] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edat_, d7edau_, d7edax_ automated match to d3wu2o_ complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edao_:
Sequence, based on SEQRES records: (download)
>d7edao_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]} tyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqeaef vptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvknl vastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeelara nvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasiep
>d7edao_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]} tyddivlankcpaypqtyriarlclqpflvkeetklvtrettsldqiqgelkvngsltfv eedgidfqpvtvqmgeripllftvknlvastsittdfkgefnvpsyrtanfldpkgrgla sgydsaialpqalaranvkrfsltkgqislnvkvdgeiagtfeseqlsdddmgahephev kiqgvfyasiep
Timeline for d7edao_: