Lineage for d7edal_ (7eda L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026391Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 3026392Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 3026432Protein automated matches [191003] (3 species)
    not a true protein
  7. 3026438Species Thermosynechococcus vulcanus [TaxId:32053] [420122] (1 PDB entry)
  8. 3026439Domain d7edal_: 7eda L: [418085]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edam_, d7edao_, d7edat_, d7edau_, d7edax_
    automated match to d5tisl_
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edal_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d7edal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7edal_ f.23.31.1 (L:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
qpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d7edal_:

Click to download the PDB-style file with coordinates for d7edal_.
(The format of our PDB-style files is described here.)

Timeline for d7edal_:

  • d7edal_ is new in SCOPe 2.08-stable