Lineage for d7edah_ (7eda H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026489Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 3026490Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 3026522Protein automated matches [191001] (5 species)
    not a true protein
  7. 3026534Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (8 PDB entries)
  8. 3026542Domain d7edah_: 7eda H: [418082]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_, d7edax_
    automated match to d2axth1
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edah_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7edah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7edah_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wk

SCOPe Domain Coordinates for d7edah_:

Click to download the PDB-style file with coordinates for d7edah_.
(The format of our PDB-style files is described here.)

Timeline for d7edah_:

  • d7edah_ is new in SCOPe 2.08-stable