Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) automatically mapped to Pfam PF00737 |
Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
Protein automated matches [191001] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (8 PDB entries) |
Domain d7edah_: 7eda H: [418082] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_, d7edax_ automated match to d2axth1 complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7edah_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wk
Timeline for d7edah_: