| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (17 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries) |
| Domain d7edad_: 7eda D: [418079] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_, d7edax_ automated match to d3wu2d_ complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7edad_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqpxenfvfpeevlprgnal
Timeline for d7edad_: