Lineage for d1gdod_ (1gdo D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36604Family d.153.1.1: Class II glutamine amidotransferases [56236] (3 proteins)
  6. 36611Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 36612Species Escherichia coli [TaxId:562] [56238] (2 PDB entries)
  8. 36616Domain d1gdod_: 1gdo D: [41807]

Details for d1gdod_

PDB Entry: 1gdo (more details), 1.8 Å

PDB Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate

SCOP Domain Sequences for d1gdod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdod_ d.153.1.1 (D:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq

SCOP Domain Coordinates for d1gdod_:

Click to download the PDB-style file with coordinates for d1gdod_.
(The format of our PDB-style files is described here.)

Timeline for d1gdod_: