SCOPe 2.08: Domain d7d5xo1: 7d5x O:1-90

Lineage for d7d5xo1 (7d5x O:1-90)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (50 PDB entries)

8. Domain d7d5xo1: 7d5x O:1-90 [417928]
   Other proteins in same PDB: d7d5xa_, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xe_, d7d5xf_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xl_, d7d5xm_, d7d5xn_, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xr_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_
   automated match to d1occb2
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, oxy, pek, pgv, po4, psc, tgl, zn

Details for d7d5xo1

PDB Entry: 7d5x, 1.74 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate, io10, at 1.74 angstrom resolution

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d7d5xo1:

Sequence; same for both SEQRES and ATOM records:

>d7d5xo1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d7d5xo1:

• d7d5xo1 is new in SCOPe 2.08-stable