| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
| Protein automated matches [254652] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [255694] (7 PDB entries) |
| Domain d7d5xf_: 7d5x F: [417919] Other proteins in same PDB: d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xe_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xl_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xr_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_ automated match to d3ag3f_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, oxy, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 7d5x (more details), 1.74 Å
SCOPe Domain Sequences for d7d5xf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d5xf_ g.41.5.3 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvph
Timeline for d7d5xf_:
View in 3DDomains from other chains: (mouse over for more information) d7d5xa_, d7d5xb1, d7d5xb2, d7d5xc_, d7d5xd_, d7d5xe_, d7d5xg_, d7d5xh_, d7d5xi_, d7d5xj_, d7d5xk_, d7d5xl_, d7d5xm_, d7d5xn_, d7d5xo1, d7d5xo2, d7d5xp_, d7d5xq_, d7d5xr_, d7d5xs_, d7d5xt_, d7d5xu_, d7d5xv_, d7d5xw_, d7d5xx_, d7d5xy_, d7d5xz_ |