Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) automatically mapped to Pfam PF02937 |
Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries) |
Domain d7d5wi_: 7d5w I: [417894] Other proteins in same PDB: d7d5wa_, d7d5wb1, d7d5wb2, d7d5wc_, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wp_, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5ww_, d7d5wx_, d7d5wy_, d7d5wz_ automated match to d1occi_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn |
PDB Entry: 7d5w (more details), 1.84 Å
SCOPe Domain Sequences for d7d5wi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d5wi_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d7d5wi_:
View in 3D Domains from other chains: (mouse over for more information) d7d5wa_, d7d5wb1, d7d5wb2, d7d5wc_, d7d5wd_, d7d5we_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wp_, d7d5wq_, d7d5wr_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_, d7d5wz_ |