Lineage for d7d5we_ (7d5w E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727293Protein automated matches [254653] (1 species)
    not a true protein
  7. 2727294Species Cow (Bos taurus) [TaxId:9913] [255695] (7 PDB entries)
  8. 2727301Domain d7d5we_: 7d5w E: [417890]
    Other proteins in same PDB: d7d5wa_, d7d5wb1, d7d5wb2, d7d5wc_, d7d5wd_, d7d5wf_, d7d5wg_, d7d5wh_, d7d5wi_, d7d5wj_, d7d5wk_, d7d5wl_, d7d5wm_, d7d5wn_, d7d5wo1, d7d5wo2, d7d5wp_, d7d5wq_, d7d5ws_, d7d5wt_, d7d5wu_, d7d5wv_, d7d5ww_, d7d5wx_, d7d5wy_, d7d5wz_
    automated match to d1ocre_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7d5we_

PDB Entry: 7d5w (more details), 1.84 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of o at 1.84 angstrom resolution
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d7d5we_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d5we_ a.118.11.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d7d5we_:

Click to download the PDB-style file with coordinates for d7d5we_.
(The format of our PDB-style files is described here.)

Timeline for d7d5we_:

  • d7d5we_ is new in SCOPe 2.08-stable