Lineage for d7czda_ (7czd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743707Domain d7czda_: 7czd A: [417868]
    Other proteins in same PDB: d7czdb1, d7czdb2, d7czdd1, d7czdd2
    automated match to d1wz1h_
    complexed with edo, peg

Details for d7czda_

PDB Entry: 7czd (more details), 1.64 Å

PDB Description: crystal structure of pd-l1 in complex with a vhh
PDB Compounds: (A:) anti-PD-L1 VHH

SCOPe Domain Sequences for d7czda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7czda_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlqesggglvqpggslrlscaasgftfssywmywlrqapgkglewvssinsdssstyy
rdsvkgrftisrdnakntlylqmnslksedtavyycakdpggyakgqgtqvtvssd

SCOPe Domain Coordinates for d7czda_:

Click to download the PDB-style file with coordinates for d7czda_.
(The format of our PDB-style files is described here.)

Timeline for d7czda_:

  • d7czda_ is new in SCOPe 2.08-stable