Lineage for d7cp5x_ (7cp5 X:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025247Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 3025248Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 3025249Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025250Species Cow (Bos taurus) [TaxId:9913] [81420] (33 PDB entries)
  8. 3025270Domain d7cp5x_: 7cp5 X: [417861]
    Other proteins in same PDB: d7cp5a_, d7cp5b1, d7cp5b2, d7cp5c_, d7cp5d_, d7cp5e_, d7cp5f_, d7cp5g_, d7cp5h_, d7cp5i_, d7cp5j_, d7cp5l_, d7cp5m_, d7cp5n_, d7cp5o1, d7cp5o2, d7cp5p_, d7cp5q_, d7cp5r_, d7cp5s_, d7cp5t_, d7cp5u_, d7cp5v_, d7cp5w_, d7cp5y_, d7cp5z_
    automated match to d7cohk_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7cp5x_

PDB Entry: 7cp5 (more details), 1.76 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of e at 1.76 angstrom resolution
PDB Compounds: (X:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d7cp5x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cp5x_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d7cp5x_:

Click to download the PDB-style file with coordinates for d7cp5x_.
(The format of our PDB-style files is described here.)

Timeline for d7cp5x_:

  • d7cp5x_ is new in SCOPe 2.08-stable