SCOPe 2.08: Domain d7cp5c_: 7cp5 C:

Lineage for d7cp5c_ (7cp5 C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d7cp5c_: 7cp5 C: [417839]
   Other proteins in same PDB: d7cp5a_, d7cp5b1, d7cp5b2, d7cp5d_, d7cp5e_, d7cp5f_, d7cp5g_, d7cp5h_, d7cp5i_, d7cp5j_, d7cp5k_, d7cp5l_, d7cp5m_, d7cp5n_, d7cp5o1, d7cp5o2, d7cp5q_, d7cp5r_, d7cp5s_, d7cp5t_, d7cp5u_, d7cp5v_, d7cp5w_, d7cp5x_, d7cp5y_, d7cp5z_
   automated match to d3ag3c_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn

Details for d7cp5c_

PDB Entry: 7cp5, 1.76 Å

PDB Description: bovine heart cytochrome c oxidase in a catalytic intermediate of e at 1.76 angstrom resolution

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7cp5c_:

Sequence; same for both SEQRES and ATOM records:

>d7cp5c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d7cp5c_:

• d7cp5c_ is new in SCOPe 2.08-stable