Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
Domain d7cp5c_: 7cp5 C: [417839] Other proteins in same PDB: d7cp5a_, d7cp5b1, d7cp5b2, d7cp5d_, d7cp5e_, d7cp5f_, d7cp5g_, d7cp5h_, d7cp5i_, d7cp5j_, d7cp5k_, d7cp5l_, d7cp5m_, d7cp5n_, d7cp5o1, d7cp5o2, d7cp5q_, d7cp5r_, d7cp5s_, d7cp5t_, d7cp5u_, d7cp5v_, d7cp5w_, d7cp5x_, d7cp5y_, d7cp5z_ automated match to d3ag3c_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, po4, psc, tgl, zn |
PDB Entry: 7cp5 (more details), 1.76 Å
SCOPe Domain Sequences for d7cp5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cp5c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d7cp5c_:
View in 3D Domains from other chains: (mouse over for more information) d7cp5a_, d7cp5b1, d7cp5b2, d7cp5d_, d7cp5e_, d7cp5f_, d7cp5g_, d7cp5h_, d7cp5i_, d7cp5j_, d7cp5k_, d7cp5l_, d7cp5m_, d7cp5n_, d7cp5o1, d7cp5o2, d7cp5p_, d7cp5q_, d7cp5r_, d7cp5s_, d7cp5t_, d7cp5u_, d7cp5v_, d7cp5w_, d7cp5x_, d7cp5y_, d7cp5z_ |