Lineage for d7cllb2 (7cll B:140-424)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837619Species Mycobacterium tuberculosis [TaxId:83332] [395131] (3 PDB entries)
  8. 2837621Domain d7cllb2: 7cll B:140-424 [417817]
    Other proteins in same PDB: d7clla1, d7cllb1, d7cllc1, d7clld1
    automated match to d6l7da2
    complexed with 2pg, act, cl, gol, mg, peg

Details for d7cllb2

PDB Entry: 7cll (more details), 1.99 Å

PDB Description: mycobacterium tubeculosis enolase in complex with 2-phosphoglycerate
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d7cllb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cllb2 c.1.11.0 (B:140-424) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ilpvpmmnilnggahadtavdiqefmvapigapsfvealrwgaevyhalksvlkkeglst
glgdeggfapdvagttaaldlisraiesaglrpgadvalaldaaatefftdgtgyvfegt
trtadqmtefyagllgayplvsiedplseddwdgwaaltasigdrvqivgddifvtnper
leegiergvanallvkvnqigtltetldavtlahhggyrtmishrsgetedtmiadlava
igsgqiktgaparservakynqllrieealgdaaryagdlafprf

SCOPe Domain Coordinates for d7cllb2:

Click to download the PDB-style file with coordinates for d7cllb2.
(The format of our PDB-style files is described here.)

Timeline for d7cllb2:

  • d7cllb2 is new in SCOPe 2.08-stable