Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [395131] (3 PDB entries) |
Domain d7cllb2: 7cll B:140-424 [417817] Other proteins in same PDB: d7clla1, d7cllb1, d7cllc1, d7clld1 automated match to d6l7da2 complexed with 2pg, act, cl, gol, mg, peg |
PDB Entry: 7cll (more details), 1.99 Å
SCOPe Domain Sequences for d7cllb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cllb2 c.1.11.0 (B:140-424) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ilpvpmmnilnggahadtavdiqefmvapigapsfvealrwgaevyhalksvlkkeglst glgdeggfapdvagttaaldlisraiesaglrpgadvalaldaaatefftdgtgyvfegt trtadqmtefyagllgayplvsiedplseddwdgwaaltasigdrvqivgddifvtnper leegiergvanallvkvnqigtltetldavtlahhggyrtmishrsgetedtmiadlava igsgqiktgaparservakynqllrieealgdaaryagdlafprf
Timeline for d7cllb2: